TREX1, Human Recombinant, 50 mg three-prime repair exonuclease 1
Item No.
61171174
TREX1, Human Recombinant Protein Ordering Info: Part Number Size (mg) 61171172 10 61171173 20 61171174 50 Product Number: P005H.1 Product Type: Active recombinant protein Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA Synonyms: DRN3, DNase III, AGS1,
Description
TREX1, Human Recombinant Protein
![](/content/files/icons/pdf-ico.jpg)
Ordering Info:
Product Number: P005H.1
Product Type: Active recombinant protein
Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA
Synonyms: DRN3, DNase III, AGS1, AGS5, HERNS, CRV
UniProt: Q9NSU2
NCBI: NP_009179.2, NM_007248.5
Organism: Human
Host: Escherichia coli
Tagging: untagged
Region: 1 – 242
Sequence: MGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPP
PRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWC
LVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLG
SIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASAR
TK
Calculated MW: 25.9 kDa
Preparation: four-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 100 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme demonstrates activity in an exonuclease assay with single-stranded DNA substrate
Storage: -80C
Shipping: shipped on dry ice
Keywords: Excella
![](/content/files/icons/pdf-ico.jpg)
Ordering Info:
Part Number | Size (mg) |
---|---|
61171172 | 10 |
61171173 | 20 |
61171174 | 50 |
Product Number: P005H.1
Product Type: Active recombinant protein
Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA
Synonyms: DRN3, DNase III, AGS1, AGS5, HERNS, CRV
UniProt: Q9NSU2
NCBI: NP_009179.2, NM_007248.5
Organism: Human
Host: Escherichia coli
Tagging: untagged
Region: 1 – 242
Sequence: MGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPP
PRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWC
LVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLG
SIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASAR
TK
Calculated MW: 25.9 kDa
Preparation: four-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 100 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme demonstrates activity in an exonuclease assay with single-stranded DNA substrate
Storage: -80C
Shipping: shipped on dry ice
Keywords: Excella
Item Info:
Item Title | TREX1, Human Recombinant, 50 mg three-prime repair |
exonuclease 1 | |
Sales Unit of Measure | EA1 |
Last Date/Time Modified | 3/20/2024 9:20:31 AM |
LSD1, Human Recombinant, 10 mg lysine-specific dem
Item No.
61171196
$310.00