TREX1, Murine Recombinant, 10 mg three-prime repair exonuclease 1
Item No.
61171175
TREX1, Murine Recombinant Protein Ordering Info: Part Number Size (mg) 61171175 10 61171176 100 61171177 1000 Product Number: P005M.1 Product Type: Active recombinant protein Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA Synonyms: DRN3, DNase III,
Description
TREX1, Murine Recombinant Protein
![](/content/files/icons/pdf-ico.jpg)
Ordering Info:
Product Number: P005M.1
Product Type: Active recombinant protein
Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA
Synonyms: DRN3, DNase III, AGS1, AGS5, HERNS, CRV
UniProt: Q991XB0
NCBI: NP_001012236.1, NM_001012236.1
Organism: Mouse
Host: Escherichia coli
Tagging: untagged
Region: 1 – 235
Sequence: MGSQTLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRP
PRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCC
LVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLG
SIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYGT
Calculated MW: 25.7 kDa
Preparation: four-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 100 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme demonstrates activity in an exonuclease assay with single-stranded DNA substrate
Storage: -80C
Shipping: shipped on dry ice
Keywords: Excella
![](/content/files/icons/pdf-ico.jpg)
Ordering Info:
Part Number | Size (mg) |
---|---|
61171175 | 10 |
61171176 | 100 |
61171177 | 1000 |
Product Number: P005M.1
Product Type: Active recombinant protein
Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA
Synonyms: DRN3, DNase III, AGS1, AGS5, HERNS, CRV
UniProt: Q991XB0
NCBI: NP_001012236.1, NM_001012236.1
Organism: Mouse
Host: Escherichia coli
Tagging: untagged
Region: 1 – 235
Sequence: MGSQTLPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALENTSISQGHPPPVPRP
PRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCC
LVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQASSPSGNGSRKSYSLG
SIYTRLYWQAPTDSHTAEGDVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYGT
Calculated MW: 25.7 kDa
Preparation: four-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 100 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme demonstrates activity in an exonuclease assay with single-stranded DNA substrate
Storage: -80C
Shipping: shipped on dry ice
Keywords: Excella
Item Info:
Item Title | TREX1, Murine Recombinant, 10 mg three-prime repai |
r exonuclease 1 | |
Sales Unit of Measure | EA1 |
Last Date/Time Modified | 3/20/2024 9:20:34 AM |
Cooler Jacket, 7oz., XL
Item No.
71051003
$63.00