TREX1, Human Recombinant, 10 mg three-prime repair exonuclease 1

TREX1, Human Recombinant Protein


Ordering Info:

Part Number	Size (mg)
61171172	10
61171173	20
61171174	50

Product Number: P005H.1
Product Type: Active recombinant protein
Function: Exonucleolytic digestion of single-stranded (ss) and double-stranded (ds) DNA
Synonyms: DRN3, DNase III, AGS1, AGS5, HERNS, CRV
UniProt: Q9NSU2
NCBI: NP_009179.2, NM_007248.5
Organism: Human
Host: Escherichia coli
Tagging: untagged
Region: 1 – 242
Sequence: MGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPP
PRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWC
LVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLG
SIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASAR
TK
Calculated MW: 25.9 kDa
Preparation: four-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 100 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme demonstrates activity in an exonuclease assay with single-stranded DNA substrate
Storage: -80C
Shipping: shipped on dry ice

Keywords: Excella