STING, Human Recombinant, AQ Variant, 1000 mg stimulator of interferon genes
Item No.
61171168
STING, Human Recombinant Protein Ordering Info: Part Number Size (mg) 61171166 10 61171167 100 61171168 1000 Product Number: P003H.3 Product Type: Active recombinant protein; G230A, R293Q (HAQ) variant Function: Transmits immune signals initiated by cGAS in response to a presence of bacterial
Description
STING, Human Recombinant Protein

Ordering Info:
Product Number: P003H.3
Product Type: Active recombinant protein; G230A, R293Q (HAQ) variant
Function: Transmits immune signals initiated by cGAS in response to a presence of bacterial and viral DNA in
the cytosol
Synonyms: MITA, TMEM173, SAVI, MPYS, NET23, ERIS, hSTING, hMITA
UniProt: Q86WV6
NCBI: NP_938023.1, NM_198282.3
Organism: Human
Host: Escherichia coli
Tagging: N-terminal 6xHis
Region: 139 – 345
Sequence: LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMA DPNIRFLDKLPQQTADRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFC
QTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV
Calculated MW: 24.1 kDa
Keywords: Excella
Ordering Info:
| Part Number | Size (mg) |
|---|---|
| 61171166 | 10 |
| 61171167 | 100 |
| 61171168 | 1000 |
Product Number: P003H.3
Product Type: Active recombinant protein; G230A, R293Q (HAQ) variant
Function: Transmits immune signals initiated by cGAS in response to a presence of bacterial and viral DNA in
the cytosol
Synonyms: MITA, TMEM173, SAVI, MPYS, NET23, ERIS, hSTING, hMITA
UniProt: Q86WV6
NCBI: NP_938023.1, NM_198282.3
Organism: Human
Host: Escherichia coli
Tagging: N-terminal 6xHis
Region: 139 – 345
Sequence: LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMA DPNIRFLDKLPQQTADRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFC
QTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV
Calculated MW: 24.1 kDa
Keywords: Excella
Item Info:
| Item Title | STING, Human Recombinant, AQ Variant, 1000 mg stim |
| ulator of interferon genes | |
| Sales Unit of Measure | EA1 |
| Last Date/Time Modified | 3/20/2024 9:20:19 AM |