NDM-1, K.pneumoniae Recombinant, His-tagged,100 mg New Delhi metallo-beta-lactamase-1

Item No. 61171191
NDM-1, Recombinant Protein Ordering Info: Part Number Size (mg) 61171190 10 61171191 100 61171192 1000 Product Number: P008B.2 Product Type: Active recombinant protein Function: Degrades beta-lactam antibiotics Synonyms: metallo-beta-lactamase type II, NDM carbapenemase, New Delhi
EA1
Price
$890.00
price per EA1
excl. tax
This product cannot be ordered at the moment.
Description
NDM-1, Recombinant Protein


Ordering Info:
Part NumberSize (mg)
6117119010
61171191100
611711921000


Product Number: P008B.2
Product Type: Active recombinant protein
Function: Degrades beta-lactam antibiotics
Synonyms: metallo-beta-lactamase type II, NDM carbapenemase, New Delhi metallo-beta-lactamase-1
UniProt: C7C422
NCBI: WP_004201164.1, NZ_LAFX01000011.1
Organism: Klebsiella pneumoniae
Host: Escherichia coli
Tagging: N-terminal 6xHis (cleavable)
Region: 29 – 270
Sequence: GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLV
VDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQL
APQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGC
LIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADK
LR
Calculated MW: 27.3 kDa (with tag and linker)
Preparation: three-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM HEPES pH 7.6, 150 mM NaCl, 20% glycerol
Activity check: active as assayed by its ability to hydrolyze a fluorescent β-lactamase substrate
Storage: -80C
Shipping: shipped on dry ice

Keywords: Excella
Item Info:
Item Title NDM-1, K.pneumoniae Recombinant, His-tagged,100 mg
New Delhi metallo-beta-lactamase-1
Sales Unit of Measure EA1
Last Date/Time Modified 3/20/2024 9:22:13 AM
    Loading
    Loading