LSD1, Human Recombinant, 10 mg lysine-specific demethylase 1

Item No. 61171196
LSD1, Human Recombinant Protein Ordering Info: Part Number Size (mg) 61171196 10 61171197 100 61171198 500 Product Number: P010H.1 Product Type: Active recombinant protein Function: Modifies histone H3 by demethylating Lys-4 and Lys-9, acting thereby as a coactivator or a corepressor Synonyms:
EA1
Price
$310.00
price per EA1
excl. tax
This product cannot be ordered at the moment.
Description
LSD1, Human Recombinant Protein


Ordering Info:
Part NumberSize (mg)
6117119610
61171197100
61171198500


Product Number: P010H.1
Product Type: Active recombinant protein
Function: Modifies histone H3 by demethylating Lys-4 and Lys-9, acting thereby as a coactivator or a
corepressor
Synonyms: KDM1A, KIAA0601, AOF2, BHC110, CPRF
UniProt: O60341
NCBI: NP_001009999.1, NM_001009999.3
Organism: Human
Host: Escherichia coli
Tagging: N-terminal 6xHis
Region: 172-836
Sequence: SGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATL
QQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTL
Calculated MW: 74.8 kDa (including tag)
Preparation: five-stage chromatographic purification
Purification grade: crystallography
Purity: >95% (as determined by SDS PAGE and Size Exclusion Chromatography)
Formulation: 20 mM Tris/HCl pH 7.5, 200 mM NaCl, 1 mM DTT, 20% glycerol
Activity check: the enzyme activity has been validated in peroxidase-coupled assay with methylated histone H3
tail peptide (H3K4Me2) (Forneris et al, 2005)
Storage: -80C
Shipping: shipped on dry ice

Keywords: Excella
Item Info:
Item Title LSD1, Human Recombinant, 10 mg lysine-specific dem
ethylase 1
Sales Unit of Measure EA1
Last Date/Time Modified 3/20/2024 9:22:48 AM
Loading
Loading